PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_025333-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 187aa    MW: 21487.6 Da    PI: 9.5497
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_025333-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.87.7e-111469148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT........TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg........kgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g ++   + m         + R+ k+c++rw +yl
    NNU_025333-RA 14 KGPWTPEEDIILVSYIQEHGPGVFDYYESLMItgfcesqgLLRCSKSCRLRWTNYL 69
                     79********************66665566666678899999************97 PP

2Myb_DNA-binding475.9e-1575120148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
    NNU_025333-RA  75 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 120
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-17572IPR009057Homeodomain-like
PROSITE profilePS500908.595969IPR017877Myb-like domain
SuperFamilySSF466894.39E-2511116IPR009057Homeodomain-like
SMARTSM007172.3E-61371IPR001005SANT/Myb domain
PfamPF002492.9E-91469IPR001005SANT/Myb domain
CDDcd001672.40E-61669No hitNo description
PROSITE profilePS5129423.25970124IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-2573125IPR009057Homeodomain-like
SMARTSM007173.5E-1374122IPR001005SANT/Myb domain
PfamPF002492.3E-1375120IPR001005SANT/Myb domain
CDDcd001671.39E-977120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MGRPPCCDKV GIKKGPWTPE EDIILVSYIQ EHGPGVFDYY ESLMITGFCE SQGLLRCSKS  60
CRLRWTNYLR PGIKRGNFTP HEEGMIIHLQ ALLGNKWAAI ASYLPQRTDN DIKNYWNTHL  120
KKKIKKFQTA LDPQLVSNST NRHLVSKSYS DKRNLDINNH VSLLRLNQSS TYASSTENIS  180
RLLEGWM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-231212425128MYB TRANSFORMING PROTEIN
1mse_C7e-23141244105C-Myb DNA-Binding Domain
1msf_C7e-23141244105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010246153.11e-121PREDICTED: myb-related protein 306
SwissprotP813922e-76MYB06_ANTMA; Myb-related protein 306
TrEMBLU5FEG72e-98U5FEG7_POPTR; Uncharacterized protein
STRINGPOPTR_0019s06290.16e-98(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.11e-86myb domain protein 60